Protein coding transcript 162461

• Transcript: Ll_transcript_163482
• CDS coordinates: 1-564 (+)
• Peptide sequence: VHIQYRGEMSEKINKYWRENNAVIRHTKTAKRFFCHRSLPPPMAQTETLTLIHEIESLISDKLQVVSYKWLSRNYMISSDEAKRLLQEFVEKHDGGLEVLYALSGWLKSSHPSYHVKLATAPKLEEARQEFDGNCSVQVYSVQSSLPKDPAMLWNAEFIQAQEFSKQPFSVDNCLRDNREEQSYKNR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_163482

• Blastp: DNA polymerase delta subunit 3 from Mus with 31.86% of identity
• Blastx: DNA polymerase delta subunit 3 from Mus with 31.86% of identity
• Eggnog: nucleotide-excision repair, DNA gap filling(ENOG410XSD1)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443862.1)
• Pfam: DNA polymerase subunit Cdc27 (PF09507.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;