Protein coding transcript 162483

• Transcript: Ll_transcript_164423
• CDS coordinates: 1430-2077 (+)
• Peptide sequence: MEEIGQAKNRVLAADEWLRVKGCEAVYALGDCCTINQRKIMDDISDIFKAADKNNSGILTIEEFKDVMGDVVLRYPQVELYLKKEHLLDLTTLLKDSQGNQRKEIDIEGFKQALSNVDSQVKVLPATAQVAAQQGEYLARCFNRMDKCEDHPEGPRRFRGPGHHQFRPFQYKHFGQFAPLGGEQAAAELPGDWVSMGHSTQWLWYSVYASKQVSWR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_164423

• Blastp: External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial from Solanum with 72.22% of identity
• Blastx: External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial from Solanum with 72.3% of identity
• Eggnog: Nadh dehydrogenase(COG1252)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448973.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;