Transcript | Ll_transcript_510844 |
---|---|
CDS coordinates | 3-416 (+) |
Peptide sequence | TIEIRHKKKSQLRKVTGFQFAPGNPSEVLVTSADSRIRILSGSEVVHKFRGFRNANSQIAASFSPDGRYIISASEDSQVYVWKHEEHRSAGSGKGKNVLVTRSHEHFQCKDVSIAIPWPNTIRGDPPPVPVHHSKRHP |
ORF Type | internal |
Blastp | WD repeat-containing protein 44 from Bos with 48.61% of identity |
---|---|
Blastx | WD repeat-containing protein 44 from Bos with 48.61% of identity |
Eggnog | WD repeatcontaining protein(ENOG410XQPJ) |
Kegg | Link to kegg annotations (286825) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448589.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer