Protein coding transcript 1626

• Transcript: Ll_transcript_510844
• CDS coordinates: 3-416 (+)
• Peptide sequence: TIEIRHKKKSQLRKVTGFQFAPGNPSEVLVTSADSRIRILSGSEVVHKFRGFRNANSQIAASFSPDGRYIISASEDSQVYVWKHEEHRSAGSGKGKNVLVTRSHEHFQCKDVSIAIPWPNTIRGDPPPVPVHHSKRHP
• ORF Type: internal

Annotations of Ll_transcript_510844

• Blastp: WD repeat-containing protein 44 from Bos with 48.61% of identity
• Blastx: WD repeat-containing protein 44 from Bos with 48.61% of identity
• Eggnog: WD repeatcontaining protein(ENOG410XQPJ)
• Kegg: Link to kegg annotations (286825)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448589.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;