Protein coding transcript 162687

• Transcript: Ll_transcript_164682
• CDS coordinates: 39-1106 (+)
• Peptide sequence: MKIQTSSIFFLLTVLTTVSLADKLTSATFNGAIYSDRTRNDKKQRLSPISFKNNNTPIATAATGTDCEVWSKECSEAVLSMARRPEMVEWIRKIRRRIHENPELAFEEIETSGLIRKELDMMKISYRYPVAKTGIRAWIGTGGPPFVAIRADMDALPIEEAVELEYKSKVAGKMHACGHDAHVAMLMGAAKILKTREHLLKGTVILLFQPGEEAGNGAKKMIEDGALENVEAIFGVHVFHHLETSIIGSRPGSFLAGCGIFRALISGKKGTATNPVLAASAAIISLQGIVSRESDPLDTQVVSVTLFNGADNHDIIPDTVVIGGTFRAFSNTTFYYLLERIKQVALKLLLSILFCV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_164682

• Blastp: IAA-amino acid hydrolase ILR1-like 6 from Arabidopsis with 66.56% of identity
• Blastx: IAA-amino acid hydrolase ILR1-like 6 from Arabidopsis with 66.56% of identity
• Eggnog: amidohydrolase(COG1473)
• Kegg: Link to kegg annotations (AT1G44350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438581.1)
• Pfam: Peptidase family M20/M25/M40 (PF01546.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;