| Transcript | Ll_transcript_510879 |
|---|---|
| CDS coordinates | 1-357 (+) |
| Peptide sequence | AEYKAGVVPIKYRRVPCIRTGGIRFSISPHSNPYYLLVLIWNVAGAGDVESVMIKGDKGKPFKPMKRNWGQNWESDDNYVGQSITFRVRTSDGKKSTSWHVVPNTWQFGQTYEGKNFR* |
| ORF Type | 5prime_partial |
| Blastp | Expansin-A16 from Arabidopsis with 57.63% of identity |
|---|---|
| Blastx | Expansin-A16 from Arabidopsis with 57.63% of identity |
| Eggnog | expansin(ENOG410YEM2) |
| Kegg | Link to kegg annotations (AT3G55500) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_015950007.1) |
| Pfam | Pollen allergen (PF01357.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer