Transcript | Ll_transcript_162500 |
---|---|
CDS coordinates | 611-1087 (+) |
Peptide sequence | MTKTHYYLVDTSVITPGAAVSELQFNIISEEPFVVHGLKLTPLPVWHGKGYRSLGFRFGNICYISDVSDIPEETYPLLMDCEILIMDALRPDRSTATHFGLPRALEEVRKIRPKRTLFTGMMHLMDHEEVNDYLSKLMESEGLDVKLSYDGLRVPVKL* |
ORF Type | complete |
Blastp | Putative hydrolase C777.06c from Schizosaccharomyces with 30.82% of identity |
---|---|
Blastx | Putative hydrolase C777.06c from Schizosaccharomyces with 35.38% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPCC777.06c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455787.1) |
Pfam | Beta-lactamase superfamily domain (PF12706.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer