Protein coding transcript 162851

• Transcript: Ll_transcript_161955
• CDS coordinates: 748-1149 (+)
• Peptide sequence: MLYRGGMRTPNTQKIEQITVQLSKYGKIEGKNVFYWFQNHKARERQKQKRKSLGLPLSPRTPTFTSSITFETTMVCYSYTNTSIYGEVDEEDSPYKKCRSMAFEYLEEQNWLSCKKEEHKTLELFPLYPELGR*
• ORF Type: complete

Annotations of Ll_transcript_161955

• Blastp: WUSCHEL-related homeobox 4 from Arabidopsis with 49.66% of identity
• Blastx: WUSCHEL-related homeobox 4 from Arabidopsis with 54.71% of identity
• Eggnog: homeobox(ENOG410YND1)
• Kegg: Link to kegg annotations (AT1G46480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447143.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;