Transcript | Ll_transcript_161974 |
---|---|
CDS coordinates | 134-514 (+) |
Peptide sequence | MGSMKVHQFTRGGFWEHEPLSLTLGCKRLRPLAPKLSNSNITTTIPFDLKSFIKPESGSTKLGSSYDDNKKDPPSPKDQVETHPGGTRWNPTQEQIRILEMLYRGGMRTPNTQKIEQITVQLSKGK* |
ORF Type | complete |
Blastp | WUSCHEL-related homeobox 4 from Arabidopsis with 57.46% of identity |
---|---|
Blastx | WUSCHEL-related homeobox 4 from Arabidopsis with 55.22% of identity |
Eggnog | homeobox(ENOG410YND1) |
Kegg | Link to kegg annotations (AT1G46480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447143.1) |
Pfam | Homeobox domain (PF00046.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer