Protein coding transcript 16305

• Transcript: Ll_transcript_276849
• CDS coordinates: 147-689 (+)
• Peptide sequence: MLQVDPEVFKTSSRKGAIVDSGTTLAFFNEGVYNPLVDAITRTIPPSVGTTDSDGYHCYLVTNSELSIINIFPLVSLNFANQASMVLRPEDYLLPLPMLGGEKWCIGFQKAQDQTILGDIILKDKIIVYDLAKQRIGWTYHNCSLPFNVSTRSSGKSITEKGGTLHLTMIVVLVFFMHLI*
• ORF Type: complete

Annotations of Ll_transcript_276849

• Blastp: Aspartic proteinase-like protein 2 from Arabidopsis with 32.65% of identity
• Blastx: Aspartic proteinase-like protein 2 from Arabidopsis with 29.71% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT1G65240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452718.1)
• Pfam: Xylanase inhibitor C-terminal (PF14541.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;