Protein coding transcript 163063

• Transcript: Ll_transcript_162595
• CDS coordinates: 134-853 (+)
• Peptide sequence: MASQPDINMKMRSILVDWLIEVHRKFELMPETLYLTLNIIDRFLSMKAVPRRELQLVGISSMLIACKYEEIWAPEVNDFVYIADHAYVREHILIMEKTILSKLEWYLTVPTPYVFLVRYIKASTPSDKEIENMVFFLAELSLMDYSIVINYCPSLIAASAVYAARCTLGRSPYWTETLRHYTGYSEEQLRGCSKIMANFHSAAPESKLRAVYKKFSSSERSAVALVDPAKYLLAPSPQS*
• ORF Type: complete

Annotations of Ll_transcript_162595

• Blastp: Cyclin-B1-3 from Arabidopsis with 64.56% of identity
• Blastx: G2/mitotic-specific cyclin S13-6 from Soja with 64.83% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (AT3G11520)
• CantataDB: Link to cantataDB annotations (CNT0000929)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434553.1)
• Pfam: Cyclin, N-terminal domain (PF00134.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;