Protein coding transcript 163067

• Transcript: Ll_transcript_162621
• CDS coordinates: 2-589 (+)
• Peptide sequence: SARSKAACGLTHKPKDLVLVDDIDVADIANELEAVEYLDDIYKFYKLTEDDGRVHDYMPSQPDINIKMRSILFDWLIEVHRKFELMQETLYLTLNIVDRFLSMKAVPRRELQLVGISSMLIACKYEEIWAPEVHDFVCISDNAYVRENILIMEKTILSKLEWYLTVPTTYVFLVRYIKASTPYDKKVSLLHSLMM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_162621

• Blastp: G2/mitotic-specific cyclin S13-6 from Soja with 67.88% of identity
• Blastx: G2/mitotic-specific cyclin-1 from Antirrhinum with 66.11% of identity
• Eggnog: g2 mitotic-specific(COG5024)
• Kegg: Link to kegg annotations (547920)
• CantataDB: Link to cantataDB annotations (CNT0000929)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460271.1)
• Pfam: Cyclin, N-terminal domain (PF00134.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;