Protein coding transcript 163130

• Transcript: Ll_transcript_164571
• CDS coordinates: 377-1051 (+)
• Peptide sequence: MAREKIQIKKIDNTTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSSSMREILKRHHLHSKNLAKMEQPSLELQLVENSNYTTLSKEVADKSHLLRQMRGEDLHGLDIEELQQLERFLQVGLGRVIEKKGEKIMNEITDLETKGMHLMEENERLKRQVANITNGQMHESENIVGDEAGQSSAESATNFGTGPPHDSDSSDTSLKLGLPYQG*
• ORF Type: complete

Annotations of Ll_transcript_164571

• Blastp: MADS-box protein SVP from Arabidopsis with 68.46% of identity
• Blastx: MADS-box protein SVP from Arabidopsis with 68.46% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G22540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421406.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;