Protein coding transcript 163132

• Transcript: Ll_transcript_164573
• CDS coordinates: 471-1133 (+)
• Peptide sequence: MAREKIQIKKIDNITARQVTFSKRRKGLFKKAKELSVLCDADVALIIFSSTGKLFEYSSSSMKEILERHHLHSKNLAKMEQPSLELQLVENSNYTKLRKEVAEKSHQLRQMRGEDLHGLDIDELQQLERSLEDGLGRVIQKKGEKIMNEITDLQSKGMRLMEENERLKRHVENITNGQRHECENLVGEEGQSSESVTNICNSTGSPHAYSDSSNTSLKLG*
• ORF Type: complete

Annotations of Ll_transcript_164573

• Blastp: MADS-box protein JOINTLESS from Lycopersicon with 70.46% of identity
• Blastx: MADS-box protein JOINTLESS from Lycopersicon with 70% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445394.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;