Protein coding transcript 163138

• Transcript: Ll_transcript_163061
• CDS coordinates: 195-587 (+)
• Peptide sequence: MRAIESPSTLDDQQWLTYWVLYSFTTLFELSCYKILLWFPIWPYMKLVFCLWLVLPMFNGAAYIYENYVRQYIKSIASYGGSSNYPEEYKKVLQMMTFDARKAVERYIDRYGPDAFERVIRVAEKEAKKH*
• ORF Type: complete

Annotations of Ll_transcript_163061

• Blastp: HVA22-like protein f from Arabidopsis with 62.02% of identity
• Blastx: HVA22-like protein f from Arabidopsis with 61.76% of identity
• Eggnog: receptor accessory protein(COG5052)
• Kegg: Link to kegg annotations (AT2G42820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418527.1)
• Pfam: TB2/DP1, HVA22 family (PF03134.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;