Transcript | Ll_transcript_163066 |
---|---|
CDS coordinates | 195-587 (+) |
Peptide sequence | MRAIESPSTLDDQQWLTYWVLYSFTTLFELSCYKILLWFPIWPYMKLVFCLWLVLPMFNGAAYIYENYVRQYIKSIASYGGSSNYPEEYKKVLQMMTFDARKAVERYIDRYGPDAFERVIRVAEKEAKKH* |
ORF Type | complete |
Blastp | HVA22-like protein f from Arabidopsis with 62.02% of identity |
---|---|
Blastx | HVA22-like protein f from Arabidopsis with 61.76% of identity |
Eggnog | receptor accessory protein(COG5052) |
Kegg | Link to kegg annotations (AT2G42820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418527.1) |
Pfam | TB2/DP1, HVA22 family (PF03134.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer