Protein coding transcript 163178

• Transcript: Ll_transcript_164268
• CDS coordinates: 2-436 (+)
• Peptide sequence: AIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHADYLDWSVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLAVLAKNILWVN
• ORF Type: internal

Annotations of Ll_transcript_164268

• Blastp: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Solenostemon with 95.86% of identity
• Blastx: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Solenostemon with 95.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458018.1)
• Pfam: Cobalamin-independent synthase, Catalytic domain (PF01717.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;