Protein coding transcript 163179

• Transcript: Ll_transcript_164270
• CDS coordinates: 49-399 (+)
• Peptide sequence: MCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLEKNILWVNPDCGLKTRKYTEVKPALTNVVAAAKLIRKELSK*
• ORF Type: complete

Annotations of Ll_transcript_164270

• Blastp: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 from Oryza sativa with 93.04% of identity
• Blastx: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 from Oryza sativa with 91.6% of identity
• Eggnog: Catalyzes the transfer of a methyl group from 5- methyltetrahydrofolate to homocysteine resulting in methionine formation (By similarity)(COG0620)
• Kegg: Link to kegg annotations (4352833)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442940.1)
• Pfam: Cobalamin-independent synthase, Catalytic domain (PF01717.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;