Transcript | Ll_transcript_164270 |
---|---|
CDS coordinates | 49-399 (+) |
Peptide sequence | MCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLEKNILWVNPDCGLKTRKYTEVKPALTNVVAAAKLIRKELSK* |
ORF Type | complete |
Blastp | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 from Oryza sativa with 93.04% of identity |
---|---|
Blastx | 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 from Oryza sativa with 91.6% of identity |
Eggnog | Catalyzes the transfer of a methyl group from 5- methyltetrahydrofolate to homocysteine resulting in methionine formation (By similarity)(COG0620) |
Kegg | Link to kegg annotations (4352833) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442940.1) |
Pfam | Cobalamin-independent synthase, Catalytic domain (PF01717.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer