Protein coding transcript 163181

• Transcript: Ll_transcript_164272
• CDS coordinates: 105-521 (+)
• Peptide sequence: MLTTWTGLSIPSGSPMLVFKIPLRYFWITKITRPDFFPSAFAFKILTFGILQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEEIADRINKMLAVLAKNILWVN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_164272

• Blastp: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Cryophytum with 85.15% of identity
• Blastx: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Catharanthus with 94.32% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017418440.1)
• Pfam: Cobalamin-independent synthase, Catalytic domain (PF01717.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;