Protein coding transcript 1632

• Transcript: Ll_transcript_510878
• CDS coordinates: 19-906 (+)
• Peptide sequence: MNNFHTAFIFLVCFVCSSLFQNSVASIVSSGDFNKDFFVIWSPNHVNTSADGKSRSLKLDQESGAGFASNQMFLFGKIDMQIKLVPGHSAGTVLAYYLSSDQPNRDEIDFEFLGNVSGQPYILQTNIFADGLDNREERIYLWFDPTKDFHTYSVLWNLHQIVFMVDMIPIRVYRNHADKGVAFPRWQPMSLKMSLWNGDSWATRGGKDKIDWTKGPFIASFRNYKIDACVWKGNPRFCRAGSTNNWWNHYSFSSLTSIQRRWFKWVRKYHMIYDYCQDNERFHNNLPRECSLPKY*
• ORF Type: complete

Annotations of Ll_transcript_510878

• Blastp: Probable xyloglucan endotransglucosylase/hydrolase protein 10 from Arabidopsis with 73.9% of identity
• Blastx: Probable xyloglucan endotransglucosylase/hydrolase protein 10 from Arabidopsis with 73.49% of identity
• Eggnog: xyloglucan endotransglucosylase hydrolase protein(ENOG410YAEJ)
• Kegg: Link to kegg annotations (AT2G14620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427252.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;