Transcript | Ll_transcript_162438 |
---|---|
CDS coordinates | 191-1006 (+) |
Peptide sequence | MSTLQFPKKRVAFVLIDGLGDVSLPRFGYKTPLEAAKLPNLDAIASAGVNGLMDPVEVGLACGSDTAHLSLLGYDPRVYYRGRGAFESMGAGLAMSPGDIAFKSNFATLDEKTGIVTSRRADRHFEEEGPILCAALDGMKLPSFPQYEVRVRYATEHRCGVVVKGPNLSGNISGTDPLKDNRLLLKAEALDDSDEARHTAAVVNELSKEITKILVSHPVNAKRVAEGKNIANIVLLRGCGIRIEVCSFSSYHTLQIRLSNIKLSLKIIKLS* |
ORF Type | complete |
Blastp | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 from Methanothermobacter with 44.03% of identity |
---|---|
Blastx | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 from Methanothermobacter with 44.03% of identity |
Eggnog | Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate (By similarity)(COG3635) |
Kegg | Link to kegg annotations (MTH_1591) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456099.1) |
Pfam | Metalloenzyme superfamily (PF01676.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer