Protein coding transcript 1633

• Transcript: Ll_transcript_510880
• CDS coordinates: 2-421 (+)
• Peptide sequence: LNISPFSYGLVVEMVYDSGTVFEPKILDIKPADLRVKFLEGAARLAAVCLQIGYPTIASAPHSIANGLKNLMAIAVETDINFKEAEMVKEYLKDPSKFAVAAAPAAAPAADKAAASPKKEAAKEESEESDEELGFGLFD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_510880

• Blastp: 60S acidic ribosomal protein P0 from Sophophora with 63.57% of identity
• Blastx: 60S acidic ribosomal protein P0 from Sophophora with 73.47% of identity
• Eggnog: 50s ribosomal protein L10(COG0244)
• Kegg: Link to kegg annotations (Dmel_CG7490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017427197.1)
• Pfam: 60s Acidic ribosomal protein (PF00428.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;