Protein coding transcript 163354

• Transcript: Ll_transcript_162541
• CDS coordinates: 102-740 (-)
• Peptide sequence: NATLLPGGLLQPLSIPTQVWMDISMDFIGSLPKSQGKDTILVVVERLTKYARFYALGHPFSAKEVASLFLNEVVKLHGFPSSIVSDRDPVFVSSFWKELFRLAGTKLKLSTAYHPQTDEQTEEVNRCLEGYLKCFAGPGPRQWGQWLAWAEFWYNSTNHSSVGMTPFRALYGMDPLMLMNAGEFPSKVKDINQLMQRMDEILKELKHNLLKA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_162541

• Blastp: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 39.64% of identity
• Blastx: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 39.64% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YGR109W-B)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459958.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;