Protein coding transcript 163381

• Transcript: Ll_transcript_162760
• CDS coordinates: 382-774 (+)
• Peptide sequence: MFGKDAPACEQVSEDEDWGPGKRKRREKESDAANTLMTLHEIENKNCNNDSIREGSSYLHKKRPCFRIPHDAVEKLRQVFAQNELPSRSMREALSKELGLDFAKVNKWFKNARYAALKTRKVNFINAFAFS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_162760

• Blastp: Pathogenesis-related homeodomain protein from Arabidopsis with 53.03% of identity
• Blastx: Pathogenesis-related homeodomain protein from Arabidopsis with 53.38% of identity
• Eggnog: PHD finger protein(ENOG410XQQA)
• Kegg: Link to kegg annotations (AT4G29940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415771.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;