Protein coding transcript 163420

• Transcript: Ll_transcript_162194
• CDS coordinates: 98-691 (+)
• Peptide sequence: MATLSETYACVPTTERGRGILISGDSKSNNILYCTARSVIIRNLDNPLQVSVYGEHAYPVTVARYSPNGEWIASADVSGTVRIWGTHNDFVLKNEFRVLSGRIDDLQWSQDGLRIVACGDGKGKSFVRAFMWDSGSTVGDFDGHSRRVLSCAFKPTRPFRIVTCGEDFLANFYEGPPFKFNMSIRQVLLYGNAYFFL*
• ORF Type: complete

Annotations of Ll_transcript_162194

• Blastp: Actin-interacting protein 1-2 from Arabidopsis with 81.97% of identity
• Blastx: Actin-interacting protein 1-2 from Arabidopsis with 81.97% of identity
• Eggnog: actin filament depolymerization(ENOG410XQN1)
• Kegg: Link to kegg annotations (AT3G18060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441466.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;