Protein coding transcript 163443

• Transcript: Ll_transcript_162323
• CDS coordinates: 3-524 (+)
• Peptide sequence: FKNQNRSRNKGKIIGRNKNWNPQKVQYMKPPAKNDSGNLLTYFKCGKPGHMARMCRNKPMDRPLQANMVDEPFVAVLSEVTMVGGTDGWWVDIGASRHVCYECVMLEKYTDADDKKVLLGDSHTTIVAGAGDVELKFTSGKTLILKDVMHTLEMRKNLVSGFLLNKAGFTQTI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_162323

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 25.13% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 26.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006577615.1)
• Pfam: Zinc knuckle (PF00098.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;