Protein coding transcript 163500

• Transcript: Ll_transcript_164506
• CDS coordinates: 1771-2139 (+)
• Peptide sequence: MAFGMQASAKSLDFIIDTASGDHPFDPYMSLMKTYGVFVLVGFPSVIKFSPGNLNIGMKTISGSITGGTKDIQEMIDFCAEKEIYPNIEVIPIDYANEALERVVKKDVKYRFVIDIENSLRA*
• ORF Type: complete

Annotations of Ll_transcript_164506

• Blastp: Probable cinnamyl alcohol dehydrogenase 1 from Arabidopsis with 71.79% of identity
• Blastx: Probable cinnamyl alcohol dehydrogenase 1 from Arabidopsis with 81.25% of identity
• Eggnog: alcohol dehydrogenase(COG1064)
• Kegg: Link to kegg annotations (AT1G72680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015943367.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;