Protein coding transcript 163513

• Transcript: Ll_transcript_164115
• CDS coordinates: 1835-2134 (+)
• Peptide sequence: MMQVRLVSDTTTNKPRGYAFIEYLHTRDMKAAYKQADGRKIDGRRVLVDVERGRTVPNWRPRRLGGGLGTTRIGGEELNQKHSGREQQQSRSEEPRVREE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_164115

• Blastp: U1 small nuclear ribonucleoprotein 70 kDa from Arabidopsis with 74.04% of identity
• Blastx: U1 small nuclear ribonucleoprotein 70 kDa from Arabidopsis with 81.69% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G50670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444761.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;