Protein coding transcript 163515

• Transcript: Ll_transcript_164090
• CDS coordinates: 64-423 (+)
• Peptide sequence: MGDFNNDPLMRNQNAAVQARAKVQNRANVLQLKLIGQSHPTGLTSNLLKLFEPRPPLEYKPPPEKRKCPPLTGMAQFVAKFAEPGDPEYAPPVKEAETPAQKKNQNSQAQTRGRSSEGC*
• ORF Type: complete

Annotations of Ll_transcript_164090

• Blastp: U1 small nuclear ribonucleoprotein 70 kDa from Arabidopsis with 81.9% of identity
• Blastx: U1 small nuclear ribonucleoprotein 70 kDa from Arabidopsis with 81.9% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G50670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444761.1)
• Pfam: U1 small nuclear ribonucleoprotein of 70kDa MW N terminal (PF12220.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;