| Transcript | Ll_transcript_163307 |
|---|---|
| CDS coordinates | 120-548 (+) |
| Peptide sequence | MGKISAKDTSWKVQKGRRKSRSSGNKYLKPGTISQLLYNQSPTSTSASVSSALVASISATACTDLGKKRVEVINSRKSKSNGGSDVKHEDKVFDKSPLMLSPLNSVKQSGLLVSPKTPRVEDCYSDSRLESLPMDLMVCSYV* |
| ORF Type | complete |
| Blastp | F-box protein At4g35930 from Arabidopsis with 36.26% of identity |
|---|---|
| Blastx | F-box protein At4g35930 from Arabidopsis with 58.05% of identity |
| Eggnog | F-box protein(ENOG41120GT) |
| Kegg | Link to kegg annotations (AT4G35930) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019420331.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer