Protein coding transcript 163665

• Transcript: Ll_transcript_244912
• CDS coordinates: 3683-4513 (+)
• Peptide sequence: MATRTFMDAPVPVDNKTATAILQYKGVPNTVLPSLPQLPAGNNTDFALNYNKKLRSLNSAKYPASVPLKVDRNLFYTIGLGKNSCPTCVNGTRLLASLNNVSFVMPQTALLQAHYFKIKGVFRTDFPEKPPTPFNYTGVPLTANLGTSTGTRVGKIAFNSTVELVLQDTNLLTVESHPFHLHGYNFFVVGTGVGNFDPAKDPPKYNLVDPVERNTVGVPTGGWTAIRFRADNPGVWFMHCHLELHTGWGLKTAFVVEDGEGEDESILPPPKDLPTC*
• ORF Type: complete

Annotations of Ll_transcript_244912

• Blastp: Laccase-11 from Arabidopsis with 78.26% of identity
• Blastx: Laccase-11 from Arabidopsis with 77.71% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT5G03260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421059.1)
• Pfam: Multicopper oxidase (PF07731.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;