Protein coding transcript 163674

• Transcript: Ll_transcript_245118
• CDS coordinates: 330-1196 (+)
• Peptide sequence: MHMMQGSSSSSMYSTLSKDDNFVFSSEDSSCPDDSNLHLGLGLTLSPSPIPPHAKIFTAKDFPSPSASSSSSSSSSLNIKSNVTSGNKRPADSVVSTNGSRQVVGWPPLRTYRMNSLNNNSKLPDAEVIKSMVDKSKSNIAVESSCDKSIIAKEKENLRSSLFVKVNKDGTPIGRKVDLSAHSSYETLARTLEDMFNEPTTVTTGKGSNGEGHGITAGTDGQSKLLDGSSNFVLTYEDGEGDWMLVGDVPWWMFLSSVRRLRIMKTCETNGLAPRLEEKSRRLKNKPI*
• ORF Type: complete

Annotations of Ll_transcript_245118

• Blastp: Auxin-responsive protein IAA11 from Arabidopsis with 46.91% of identity
• Blastx: Auxin-responsive protein IAA11 from Arabidopsis with 46.92% of identity
• Eggnog: auxin-responsive protein(ENOG410YK71)
• Kegg: Link to kegg annotations (AT4G28640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426443.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;