Protein coding transcript 163731

• Transcript: Ll_transcript_246207
• CDS coordinates: 21-359 (+)
• Peptide sequence: MFLEATTKHLNEYGEAGLRTLALAYRKLDEQEFSDWNNEFQKAKSAVGVDRESTLERISELMEKELILVGATAVEDKLQKGVSFMIIYSVYNIFAFYLLQDFYQIQFFLSPQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_246207

• Blastp: Probable phospholipid-transporting ATPase 7 from Arabidopsis with 74.12% of identity
• Blastx: Probable phospholipid-transporting ATPase 7 from Arabidopsis with 74.44% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT3G13900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456303.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;