Protein coding transcript 163734

• Transcript: Ll_transcript_246212
• CDS coordinates: 2-310 (+)
• Peptide sequence: RLVKQGTGKTTLAIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSIAQFRFLERLLVVHGHWCYKRIAQMICYFFYKNIAFGLTIFYFEAYAGFWSISL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_246212

• Blastp: Probable phospholipid-transporting ATPase 5 from Arabidopsis with 95.88% of identity
• Blastx: Probable phospholipid-transporting ATPase 5 from Arabidopsis with 95.88% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G72700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443523.1)
• Pfam: Phospholipid-translocating P-type ATPase C-terminal (PF16212.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;