Transcript | Ll_transcript_246192 |
---|---|
CDS coordinates | 3-593 (+) |
Peptide sequence | DKLQKGVSQCIDKLAQAGLKIWVLTGDKLETAINIGFACSLLRPGMKQICISLPNSNSLVNDSKEVIKSNILNQITNASQMIILEKDPHAAFALIIEGKTLTYALEDDVKHQFLGLAVGCASVICCRVSPKQKALVTRLVKQGTRKTTLAIGDGANDVGMIQEADIGVGISGVEGMQVSGCLNLHIYLFEYWYAGQ* |
ORF Type | 5prime_partial |
Blastp | Probable phospholipid-transporting ATPase 5 from Arabidopsis with 78.53% of identity |
---|---|
Blastx | Probable phospholipid-transporting ATPase 4 from Arabidopsis with 82.41% of identity |
Eggnog | Phospholipid-transporting atpase(ENOG410XPYK) |
Kegg | Link to kegg annotations (AT1G72700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443523.1) |
Pfam | haloacid dehalogenase-like hydrolase (PF08282.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer