Protein coding transcript 163739

• Transcript: Ll_transcript_246202
• CDS coordinates: 3-308 (+)
• Peptide sequence: ASDFAIAQFRFLERLLVVHGHWCYKRIAQMICYFFYKNIAFGLTIFYFEAFTSFSGQSVYDDWYMILFNVVLTSLPVISLGVFEQDVPSEVCLQFPALYQQG
• ORF Type: internal

Annotations of Ll_transcript_246202

• Blastp: Phospholipid-transporting ATPase 6 from Arabidopsis with 89.22% of identity
• Blastx: Phospholipid-transporting ATPase 6 from Arabidopsis with 89.22% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G54280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014501223.1)
• Pfam: Phospholipid-translocating P-type ATPase C-terminal (PF16212.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;