Protein coding transcript 163740

• Transcript: Ll_transcript_246209
• CDS coordinates: 120-431 (+)
• Peptide sequence: MASDFSIAQFRFLERLLVVHGHWCYKRIALMICYFFYKNIAFGLTIFYFEAYAGFSGQSVYEDWYMILFNVVLTSLPVISLGVFEQDVSSEVCLQFPALYQQGP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_246209

• Blastp: Phospholipid-transporting ATPase 6 from Arabidopsis with 87.5% of identity
• Blastx: Probable phospholipid-transporting ATPase 5 from Arabidopsis with 88.89% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G54280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014501223.1)
• Pfam: Phospholipid-translocating P-type ATPase C-terminal (PF16212.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;