Protein coding transcript 163783

• Transcript: Ll_transcript_244511
• CDS coordinates: 250-804 (+)
• Peptide sequence: MEEKPFQEFTARYYGLCTVGGILSAGATHVAMTPLDVLKVNMQVHPIKYYSISSCFTALMREQGPSALWRGWTGKFFGYGAQGGCRFGLYEYFKQVYSNMLVDQNRNLVYFLSSASAEAFANVALCPFEAIKVRVQAQPCFAKGLHDGIPKLYASEGIQGFYRGLVPLLGRNIPCNFIISWSFI*
• ORF Type: complete

Annotations of Ll_transcript_244511

• Blastp: Mitochondrial phosphate carrier protein 1, mitochondrial from Arabidopsis with 65.5% of identity
• Blastx: Mitochondrial phosphate carrier protein 1, mitochondrial from Arabidopsis with 65.5% of identity
• Eggnog: Phosphate carrier protein(ENOG410XPST)
• Kegg: Link to kegg annotations (AT2G17270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424405.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;