Transcript | Ll_transcript_244512 |
---|---|
CDS coordinates | 250-804 (+) |
Peptide sequence | MEEKPFQEFTARYYGLCTVGGILSAGATHVAMTPLDVLKVNMQVHPIKYYSISSCFTALMREQGPSALWRGWTGKFFGYGAQGGCRFGLYEYFKQVYSNMLVDQNRNLVYFLSSASAEAFANVALCPFEAIKVRVQAQPCFAKGLHDGIPKLYASEGIQGFYRGLVPLLGRNIPCNFIISWSFI* |
ORF Type | complete |
Blastp | Mitochondrial phosphate carrier protein 1, mitochondrial from Arabidopsis with 65.5% of identity |
---|---|
Blastx | Mitochondrial phosphate carrier protein 1, mitochondrial from Arabidopsis with 65.5% of identity |
Eggnog | Phosphate carrier protein(ENOG410XPST) |
Kegg | Link to kegg annotations (AT2G17270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424405.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer