Protein coding transcript 163789

• Transcript: Ll_transcript_245048
• CDS coordinates: 2-571 (+)
• Peptide sequence: MHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLEHPQKETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_245048

• Blastp: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 95.26% of identity
• Blastx: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 95.26% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT2G47650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004495956.1)
• Pfam: 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;