Protein coding transcript 163790

• Transcript: Ll_transcript_245076
• CDS coordinates: 475-876 (+)
• Peptide sequence: MLGLAKRVGARFLLTSTSEVYGDPLEHPQKETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_245076

• Blastp: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 95.52% of identity
• Blastx: UDP-glucuronic acid decarboxylase 4 from Arabidopsis with 95.8% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT2G47650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427927.1)
• Pfam: GDP-mannose 4,6 dehydratase (PF16363.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;