Protein coding transcript 163793

• Transcript: Ll_transcript_245067
• CDS coordinates: 386-868 (+)
• Peptide sequence: MDSKIEYNEEYRKNSRGVQLFTCKWLPVSSPKALVFLCHGYGMECGNFMKECGEKLACARYAVFGMDYEGHGRSGGVRCFINKFEDIVNDCYHFFKSICELQEYKGKAKFLYGESMGGAVSLLLHKKDPSLWDGAVLVAPMCKVLMNAFLLDNSFVRVRIL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_245067

• Blastp: Monoglyceride lipase from Mus with 37.31% of identity
• Blastx: Monoglyceride lipase from Mus with 37.31% of identity
• Eggnog: alpha beta hydrolase fold(COG2267)
• Kegg: Link to kegg annotations (23945)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441744.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;