Protein coding transcript 163812

• Transcript: Ll_transcript_246819
• CDS coordinates: 605-1045 (+)
• Peptide sequence: MVDVKPFRARVGAVGPVLFMKGEGCGACYKVKCLDKNICTRRAVTVIITDECPGCPSDRTHFDLSGAAFGRMAITGENGQLRNRGQIPVIYRRTPCKYPGKKIAFHVNEGSTPFWLSLLVEFEDAEGDIGSMHIREVCIFLMLFDI*
• ORF Type: complete

Annotations of Ll_transcript_246819

• Blastp: Expansin-B3 from Arabidopsis with 80.29% of identity
• Blastx: Expansin-B3 from Arabidopsis with 81.94% of identity
• Eggnog: May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity)(ENOG410YA5Q)
• Kegg: Link to kegg annotations (AT4G28250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454372.1)
• Pfam: Lytic transglycolase (PF03330.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;