Transcript | Ll_transcript_246823 |
---|---|
CDS coordinates | 111-755 (+) |
Peptide sequence | MQRHRSSAVLNLSLLCYCLVLKQLVLLCGAEGLPQHRLPDLHWYPGTATWYGEPEGDGSTGGACGYGTMVDVKPFRARVGAVGPVLFMKGEGCGACYKVKCLDKNICTRRAVTVIITDECPGCPSDRTHFDLSGAAFGRMAITGENGQLRNRGQIPVIYRRTPCKYPGKKIAFHVNEGSTPFWLSLLVEFEDAEGDIGSMHIREVCIFLMLFDI* |
ORF Type | complete |
Blastp | Expansin-B3 from Arabidopsis with 71.88% of identity |
---|---|
Blastx | Expansin-B3 from Arabidopsis with 80.37% of identity |
Eggnog | May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity)(ENOG410YA5Q) |
Kegg | Link to kegg annotations (AT4G28250) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454372.1) |
Pfam | Lytic transglycolase (PF03330.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer