Protein coding transcript 163823

• Transcript: Ll_transcript_246839
• CDS coordinates: 1821-2132 (+)
• Peptide sequence: MPHSHIRSHSHSHSHSHSQGGYGAYDAYISATTRYAALGAPTLYDRPGPIYGRSEPVRGMGNKIFVGRLPQEATSDDLRHYFGRFGRILDAYIPRVRNEINLI*
• ORF Type: complete

Annotations of Ll_transcript_246839

• Blastp: TAR DNA-binding protein 43 from Homo with 36.73% of identity
• Blastx: TAR DNA-binding protein 43 from Pongo with 36.73% of identity
• Eggnog: TAR DNA binding protein(ENOG410ZYQJ)
• Kegg: Link to kegg annotations (23435)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446782.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;