Transcript | Ll_transcript_246585 |
---|---|
CDS coordinates | 2185-2601 (+) |
Peptide sequence | MLKLGLKPVTGVSRVTIKRTKNVLFFISKPDVFKSPHSETYVIFGEAKIEDLSSQLQSQAAQQFRVPDVGSITAKPDEGAAAEAAQPDDEEEEVDETGVAPHDIDLVMTQAGVARNKAVRALKNHDGDIVSAIMELTT* |
ORF Type | complete |
Blastp | Nascent polypeptide-associated complex subunit alpha-like protein 2 from Arabidopsis with 78.26% of identity |
---|---|
Blastx | Nascent polypeptide-associated complex subunit alpha-like protein 2 from Arabidopsis with 78.42% of identity |
Eggnog | nascent polypeptide-associated complex(COG1308) |
Kegg | Link to kegg annotations (AT3G49470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416553.1) |
Pfam | NAC domain (PF01849.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer