Protein coding transcript 163887

• Transcript: Ll_transcript_246593
• CDS coordinates: 1449-1868 (+)
• Peptide sequence: MLKLGLKPVTGVSRVTIKRTKNVLFFISKPDVFKSPHSETYVIFGEAKIEDLSSQLQSQAAQQFRMPDIASISAKPDEVAAAEGAQPDEEEEDEVDETGVAPHDIDLVMTQAGVARNKAVKALKNHDGDIVSAIMELTT*
• ORF Type: complete

Annotations of Ll_transcript_246593

• Blastp: Nascent polypeptide-associated complex subunit alpha-like protein 2 from Arabidopsis with 80.58% of identity
• Blastx: Nascent polypeptide-associated complex subunit alpha-like protein 2 from Arabidopsis with 80% of identity
• Eggnog: nascent polypeptide-associated complex(COG1308)
• Kegg: Link to kegg annotations (AT3G49470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437304.1)
• Pfam: NAC domain (PF01849.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;