Transcript | Ll_transcript_245972 |
---|---|
CDS coordinates | 2-568 (+) |
Peptide sequence | FYSSFHSSIYFYRTVAKKKMGSFEAEIRSTVGWAARDPSGILSPYTFTLRNTGPDDVYIKVLYCGICHTDLHKIKNDLGTSKYPMVPGHEVVGEVLEVGSDVKRFKVGEMVGVGYFVGSCKSCHACQSDVEQYCSKIICSYNDIYTDGKPTQGGFAQTMVIEQKFVVKVPEGLAPEQVAPLLCWRDCV* |
ORF Type | 5prime_partial |
Blastp | Probable cinnamyl alcohol dehydrogenase from Medicago with 78.66% of identity |
---|---|
Blastx | Probable cinnamyl alcohol dehydrogenase 1 from Eucalyptus with 69.51% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426954.1) |
Pfam | Alcohol dehydrogenase GroES-like domain (PF08240.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer