Protein coding transcript 163908

• Transcript: Ll_transcript_245957
• CDS coordinates: 561-956 (+)
• Peptide sequence: MGVKIAKAFGHHVTVISSSDKKKKEALEHLGADAYLVSSDATSMQGAADSLDYIIDTVPVGHPLEPYLSLLKVDGKLILMGVINTPLQFVSPLVMLGRKSITGSFIGSIKETEEMLEFWKEKDLSSMIEVVN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_245957

• Blastp: Probable cinnamyl alcohol dehydrogenase from Medicago with 87.12% of identity
• Blastx: Probable cinnamyl alcohol dehydrogenase from Medicago with 86.89% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452456.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;