Protein coding transcript 163911

• Transcript: Ll_transcript_245963
• CDS coordinates: 1369-1911 (+)
• Peptide sequence: MGVKIAKAFGHKVTVISSSDKKKNEALEHLGADEYLVSSDGNSMHEATDSLDYIIDTVPVGHPLEPYLSLLKLDGKLIFMGPITTPLQFFSTTVMGGRKSITGSMVGSIKEAQEFLEFWKEKGLSSMIEVVNMDYINKALERLENNDVRYRFVVDVKGSKFGKEILNHKKTTSVDYVSPI*
• ORF Type: complete

Annotations of Ll_transcript_245963

• Blastp: Probable cinnamyl alcohol dehydrogenase from Medicago with 81.37% of identity
• Blastx: Probable cinnamyl alcohol dehydrogenase from Medicago with 82.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426954.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;