Transcript | Ll_transcript_245375 |
---|---|
CDS coordinates | 21-356 (-) |
Peptide sequence | FFFLFEMESSSVAPAGVQWHDLGSLQPLPPGFKQFSCLSLLSSWDYRHLPPRPANFCIFSRDGVSPCWSAGLKLLTLSDPPASASRSAGITGVSHRARPVQHSFLLDVWSD* |
ORF Type | 5prime_partial |
Blastp | Histone demethylase UTY from Pan with 64.29% of identity |
---|---|
Blastx | UPF0764 protein C16orf89 from Homo with 63.1% of identity |
Eggnog | repeat-containing protein(COG0457) |
Kegg | Link to kegg annotations (449579) |
CantataDB | - |
Mirbase | ppy-mir-1273a (MI0015230) |
Ncbi protein | Link to NCBI protein (XP_004513424.1) |
Pfam | - |
Rfam | Metazoa_SRP (RF00017) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer